CDC42SE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180780

Catalog No. NBP180780

Description

CDC42SE1 Polyclonal specifically detects CDC42SE1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CDC42SE1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9NRR8
• Gene Symbols: CDC42SE1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNR
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 1300002M12Rik, CDC42 small effector 1, CDC42-binding protein SCIP1, SCIP1, signaling molecule SPEC1 beta, Small effector of CDC42 protein 1, small protein effector 1 of Cdc42, SPEC1CDC42 small effector protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56882
• Target Species: Human
• Isotype: IgG

For Research Use Only