Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDCA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155143
Description
CDCA5 Polyclonal specifically detects CDCA5 in Human samples. It is validated for Western Blot.Specifications
| CDCA5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| cell division cycle associated 5, Cell division cycle-associated protein 5, MGC16386, p35, SORORIN | |
| Rabbit | |
| 28 kDa | |
| 100 μL | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| 113130 | |
| Human, Mouse, Pig, Bovine, Canine, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q96FF9 | |
| CDCA5 | |
| Synthetic peptides corresponding to CDCA5(cell division cycle associated 5) The peptide sequence was selected from the middle region of CDCA5. Peptide sequence RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction