Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDCA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CDCA5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15514320
|
Novus Biologicals
NBP15514320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP155143
|
Novus Biologicals
NBP155143 |
100 μL |
Each for $487.50
|
|
|||||
Description
CDCA5 Polyclonal specifically detects CDCA5 in Human samples. It is validated for Western Blot.Specifications
| CDCA5 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| cell division cycle associated 5, Cell division cycle-associated protein 5, MGC16386, p35, SORORIN | |
| CDCA5 | |
| IgG | |
| 28 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96FF9 | |
| 113130 | |
| Synthetic peptides corresponding to CDCA5(cell division cycle associated 5) The peptide sequence was selected from the middle region of CDCA5. Peptide sequence RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title