Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CDCA5 Antibody, Novus Biologicals™

CDCA5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15514320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15514320 20 μL
NBP155143 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15514320 Supplier Novus Biologicals Supplier No. NBP15514320UL

Description

Rabbit Polyclonal Antibody

CDCA5 Polyclonal specifically detects CDCA5 in Human samples. It is validated for Western Blot.

Specifications

Antigen CDCA5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96FF9
Gene Alias cell division cycle associated 5, Cell division cycle-associated protein 5, MGC16386, p35, SORORIN
Gene Symbols CDCA5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CDCA5(cell division cycle associated 5) The peptide sequence was selected from the middle region of CDCA5. Peptide sequence RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP.
Molecular Weight of Antigen 28 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 113130
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.