Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDCA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155143
Description
CDCA5 Polyclonal specifically detects CDCA5 in Human samples. It is validated for Western Blot.Specifications
CDCA5 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
cell division cycle associated 5, Cell division cycle-associated protein 5, MGC16386, p35, SORORIN | |
Rabbit | |
28 kDa | |
100 μL | |
Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
113130 | |
Human, Mouse, Porcine, Bovine, Canine, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q96FF9 | |
CDCA5 | |
Synthetic peptides corresponding to CDCA5(cell division cycle associated 5) The peptide sequence was selected from the middle region of CDCA5. Peptide sequence RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction