Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDK10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25777925UL
Description
CDK10 Polyclonal specifically detects CDK10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CDK10 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
Cell division protein kinase 10, cyclin-dependent kinase (CDC2-like) 10, cyclin-dependent kinase 10, cyclin-dependent kinase related protein, EC 2.7.11, EC 2.7.11.22, PISSLRECDC2-related protein kinase, serine/threonine protein kinase PISSLRE, Serine/threonine-protein kinase PISSLRE | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
CDK10 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLL | |
25 μL | |
Cell Cycle and Replication | |
8558 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction