Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CDK5 Activator 1 Antibody, Novus Biologicals™

CDK5 Activator 1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP255112 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP255112 100 μL
NB395166 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP255112 Supplier Novus Biologicals Supplier No. NBP255112
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CDK5 Activator 1 Polyclonal specifically detects CDK5 Activator 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen CDK5 Activator 1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory partner for CDK5 kinase, tau protein kinase II 23kDa subunit, TPKII regulatory subunit
Gene Symbols CDK5R1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8851
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.