Learn More
Description
Specifications
Specifications
| Antigen | CDK5 Activator 1 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory partner for CDK5 kinase, tau protein kinase II 23kDa subunit, TPKII regulatory subunit |
| Gene Symbols | CDK5R1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
