Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDK5RAP2 Antibody (CL3392), Novus Biologicals™
SDP

Catalog No. NB393161 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393161 25 μL
NBP259027 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393161 Supplier Novus Biologicals Supplier No. NBP25902725UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

CDK5RAP2 Monoclonal specifically detects CDK5RAP2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen CDK5RAP2
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias C48, CDK5 activator-binding protein C48, CDK5 regulatory subunit associated protein 2, CDK5 regulatory subunit-associated protein 2, centrosomal protein 215 kDa, Centrosome-associated protein 215, Cep215, DKFZp686B1070, DKFZp686D1070, FLJ10867, KIAA1633microcephaly, primary autosomal recessive 3, MCPH3
Gene Symbols CDK5RAP2
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Cellular Markers, Chromatin Research
Primary or Secondary Primary
Gene ID (Entrez) 55755
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.