Learn More
Description
Specifications
Specifications
| Antigen | CDK5RAP2 |
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | C48, CDK5 activator-binding protein C48, CDK5 regulatory subunit associated protein 2, CDK5 regulatory subunit-associated protein 2, centrosomal protein 215 kDa, Centrosome-associated protein 215, Cep215, DKFZp686B1070, DKFZp686D1070, FLJ10867, KIAA1633microcephaly, primary autosomal recessive 3, MCPH3 |
| Gene Symbols | CDK5RAP2 |
| Host Species | Mouse |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
