Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDK5RAP2 Antibody (CL3392), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $646.00
Specifications
Antigen | CDK5RAP2 |
---|---|
Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Monoclonal |
Conjugate | Unconjugated |
Description
CDK5RAP2 Monoclonal specifically detects CDK5RAP2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
CDK5RAP2 | |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Mouse | |
Cell Cycle and Replication, Cellular Markers, Chromatin Research | |
C48, CDK5 activator-binding protein C48, CDK5 regulatory subunit associated protein 2, CDK5 regulatory subunit-associated protein 2, centrosomal protein 215 kDa, Centrosome-associated protein 215, Cep215, DKFZp686B1070, DKFZp686D1070, FLJ10867, KIAA1633microcephaly, primary autosomal recessive 3, MCPH3 | |
CDK5RAP2 | |
IgG1 | |
Protein A purified |
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Monoclonal | |
Purified | |
RUO | |
Human | |
55755 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title