Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDP/CUTL1 Antibody (CL5278), Novus Biologicals™
SDP

Catalog No. NB393116 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393116 25 μL
NBP261409 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393116 Supplier Novus Biologicals Supplier No. NBP26140925UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

CDP/CUTL1 Monoclonal specifically detects CDP/CUTL1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen CDP/CUTL1
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL5278
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias CCAAT displacement protein, CDP/Cux, CDPCCAAT displacement protein, COY1, CUT, cut (Drosophila)-like 1 (CCAAT displacement protein), cut-like 1, CCAAT displacement protein (Drosophila), cut-like homeobox 1, FLJ31745, golgi integral membrane protein 6, GOLIM6, homeobox protein cut-like 1, Homeobox protein cux-1, Nbla10317, p100, p110, p200, p75, protein CASP, putative protein product of Nbla10317
Gene Symbols CUX1
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1523
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.