CDT2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP154644	100 μL

Catalog No. NBP154644 Supplier Novus Biologicals Supplier No. NBP154644

Description

Rabbit Polyclonal Antibody

CDT2 Polyclonal specifically detects CDT2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CDT2
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9NZJ0
• Gene Alias: CDT2RA-regulated nuclear matrix-associated protein, CDW1, DCAF2DDB1 and CUL4 associated factor 2, DDB1- and CUL4-associated factor 2, denticleless homolog (Drosophila), L2DTLRA regulated nuclear matrix associated protein, Lethal(2) denticleless protein homolog, RAMPdenticleless protein homolog, Retinoic acid-regulated nuclear matrix-associated protein
• Gene Symbols: DTL
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to CDT2. The peptide sequence was selected from the N terminal of CDT2 (NP_057532). Peptide sequence VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV.
• Molecular Weight of Antigen: 79 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
• Primary or Secondary: Primary
• Gene ID (Entrez): 51514
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only