Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CDT2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CDT2 Polyclonal specifically detects CDT2 in Human samples. It is validated for Western Blot.Specifications
CDT2 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
CDT2RA-regulated nuclear matrix-associated protein, CDW1, DCAF2DDB1 and CUL4 associated factor 2, DDB1- and CUL4-associated factor 2, denticleless homolog (Drosophila), L2DTLRA regulated nuclear matrix associated protein, Lethal(2) denticleless protein homolog, RAMPdenticleless protein homolog, Retinoic acid-regulated nuclear matrix-associated protein | |
DTL | |
IgG | |
79 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9NZJ0 | |
51514 | |
Synthetic peptides corresponding to CDT2. The peptide sequence was selected from the N terminal of CDT2 (NP_057532). Peptide sequence VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title