Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDYL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CDYL |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CDYL Polyclonal specifically detects CDYL in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
CDYL | |
Polyclonal | |
Rabbit | |
Q9Y232 | |
9425 | |
Synthetic peptides corresponding to CDYL(chromodomain protein, Y-like) The peptide sequence was selected from the n terminal of CDYL. Peptide sequence YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV. | |
Primary |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
CDYL1bA620A17.2 (chromodomain protein, Y chromosome-like), CDY-like, CDY-like, autosomal, chromodomain protein, Y chromosome-like, chromodomain protein, Y-like, chromodomain Y-like protein, DKFZP586C1622, EC 2.3.1.48, MGC131936, testis-specific chromodomain Y-like protein | |
CDYL | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title