CEACAM5/CD66e Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18574225UL

Catalog No. NB406417

Description

CEACAM5/CD66e Polyclonal specifically detects CEACAM5/CD66e in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CEACAM5/CD66e
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: Carcinoembryonic antigen, carcinoembryonic antigen-related cell adhesion molecule 5, CD66e antigen, CEACD66e, DKFZp781M2392, Meconium antigen 100
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CEACAM5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN
• Quantity: 25 μL
• Research Discipline: Cancer, Cellular Markers, Immunology
• Gene ID (Entrez): 1048
• Target Species: Human
• Isotype: IgG

For Research Use Only