Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP155290

CEACAM6/CD66c Antibody, Novus Biologicals™
SDP

Catalog No. NBP155290 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155290 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155290 Supplier Novus Biologicals Supplier No. NBP155290
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CEACAM6/CD66c Polyclonal specifically detects CEACAM6/CD66c in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CEACAM6/CD66c
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P40199
Gene Alias carcinoembryonic antigen-related cell adhesion molecule 6, carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific crossreacting antigen), CD66c, CD66c antigen, NCACEAL, Non-specific crossreacting antigen, Normal cross-reacting antigen
Gene Symbols CEACAM6
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human CEACAM6 (NP_002474). Peptide sequence: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 38 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 4680
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.