Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CEACAM7 Antibody, Novus Biologicals™

CEACAM7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP168887 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP168887 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP168887 Supplier Novus Biologicals Supplier No. NBP168887
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CEACAM7 Polyclonal specifically detects CEACAM7 in Human samples. It is validated for Western Blot.

Specifications

Antigen CEACAM7
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q14002
Gene Alias Carcinoembryonic antigen CGM 2, Carcinoembryonic antigen CGM2, Carcinoembryonic antigen gene family member 2, Carcinoembryonic antigen related cell adhesion molecule 7, CEA, CEACAM 7, CGM 2, CGM2
Gene Symbols CEACAM7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CEACAM7 (carcinoembryonic antigen-related cell adhesion molecule 7) The peptide sequence was selected from the N terminal of CEACAM7. Peptide sequence NLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLI.
Molecular Weight of Antigen 29 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 1087
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.