Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CEACAM7 Antibody, Novus Biologicals™

CEACAM7 Antibody, Novus Biologicals™
SDP

Catalog No. NB396532 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396532 25 μL
NBP239098 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396532 Supplier Novus Biologicals Supplier No. NBP23909825UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CEACAM7 Polyclonal specifically detects CEACAM7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CEACAM7
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q14002
Gene Alias Carcinoembryonic antigen CGM 2, Carcinoembryonic antigen CGM2, Carcinoembryonic antigen gene family member 2, Carcinoembryonic antigen related cell adhesion molecule 7, CEA, CEACAM 7, CGM 2, CGM2
Gene Symbols CEACAM7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RVHANYRIIGYVKNISQENAPGPAHNGRET
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 1087
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.