CEI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25799725UL

Catalog No. NB403319

Description

CEI Polyclonal specifically detects CEI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CEI
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C5orf38, CEI IRX2NB, chromosome 5 open reading frame 38, coordinated expression to IRX2, coordinated expression to IRXA2 homeobox, Coordinated expression to IRXA2 protein, IRX2 neighbor, IRX2NB, MGC126657, MGC126683, protein CEI
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 153571
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: C5ORF38
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLC
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only