Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301720

CENPI Antibody, Novus Biologicals™
SDP

Catalog No. NB301720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301720 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301720 Supplier Novus Biologicals Supplier No. NBP324732
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CENPI Polyclonal antibody specifically detects CENPI in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

Antigen CENPI
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CENP-IFSH primary response (LRPR1, rat) homolog 1, centromere protein I, Follicle-stimulating hormone primary response protein, FSH primary response 1, FSH primary response protein 1, FSHPRH1Mis6, ICEN19, Interphase centromere complex protein 19, Leucine-rich primary response protein 1, LRPR1FSH primary response (LRPR1 homolog, rat) 1, Mis6
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein CENPI using the following amino acid sequence: PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2491
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.