CENPT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25894625UL

Catalog No. NB393202

Description

CENPT Polyclonal specifically detects CENPT in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CENPT
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
• Gene Alias: C16orf56, CENP-Tchromosome 16 open reading frame 56, centromere protein T, FLJ13111, FLJ43376, ICEN22, Interphase centromere complex protein 22
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80152
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CENPT
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only