Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CEP89 Antibody, Novus Biologicals™

CEP89 Antibody, Novus Biologicals™
SDP

Catalog No. NBP238446 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238446 0.1 mL
NB396823 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238446 Supplier Novus Biologicals Supplier No. NBP238446
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CEP89 Polyclonal specifically detects CEP89 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen CEP89
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q96ST8
Gene Alias CCDC123, centrosomal protein 89kDa, centrosomal protein of 89 kDa, coiled-coil domain containing 123, coiled-coil domain-containing protein 123, mitochondrial, FLJ14640
Gene Symbols CEP89
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QVLKDKQEVLDQALQQNREMEGELEVIWESTFRENRRIRELLQDTLTRTGVQDNPRALVAPSLNGVSQADLLDGCDVCSYD
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84902
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.