Cerberus 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188030

Catalog No. NBP188030

Description

Cerberus 1 Polyclonal specifically detects Cerberus 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cerberus 1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: cerberus, cerberus 1 (Xenopus laevis) homolog (cysteine knot superfamily), cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis), cerberus-related 1, Cerberus-related protein, DAN domain family member 4, DAND4, MGC119894, MGC119895, MGC96951
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CER1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNL
• Quantity: 0.1 mL
• Research Discipline: Stem Cell Markers, Stem Cell Signaling Pathway, Wnt Signaling Pathway
• Gene ID (Entrez): 9350
• Target Species: Human
• Isotype: IgG

For Research Use Only