CHFR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26897025UL

Catalog No. NB392808

Description

CHFR Polyclonal antibody specifically detects CHFR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: CHFR
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: checkpoint with forkhead and ring finger domains, Checkpoint with forkhead and RING finger domains protein, E3 ubiquitin-protein ligase CHFR, EC 6.3.2.-, FLJ10796, FLJ33629, RING finger protein 196, RNF196RNF116
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism, Mitotic Regulators, Zinc Finger
• Gene ID (Entrez): 55743
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified