ChGn Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159218

Catalog No. NBP159218

Description

ChGn Polyclonal specifically detects ChGn in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ChGn
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: beta4GalNAcT, Beta4GalNAcT-1, CHGN, chondroitin beta1,4 N-acetylgalactosaminyltransferase, Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1, chondroitin sulfate N-acetylgalactosaminyltransferase 1, CSGalNAcT-1, EC 2.4.1.174, FLJ11264, FLJ13760, GALNACT1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TDX6
• Gene Symbols: CSGALNACT1
• Immunogen: Synthetic peptides corresponding to CSGALNACT1 The peptide sequence was selected from the N terminal of CSGALNACT1. Peptide sequence KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE.
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 55790
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.