Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHMP1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23800725UL
Description
CHMP1B Polyclonal specifically detects CHMP1B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CHMP1B | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Q7LBR1 | |
CHMP1B | |
This antibody was developed against a recombinant protein corresponding to amino acids: TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
C18orf2C10orf2, charged multivesicular body protein 1b, CHMP1.5C18-ORF2, CHMP1b, chromatin modifying protein 1B, Chromatin-modifying protein 1b, hVps46-2, vacuolar protein sorting 46-2, Vacuolar protein sorting-associated protein 46-2, Vps46-2, Vps46B | |
Rabbit | |
Affinity Purified | |
RUO | |
57132 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction