Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHMP1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CHMP1B |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CHMP1B Polyclonal specifically detects CHMP1B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CHMP1B | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
C18orf2C10orf2, charged multivesicular body protein 1b, CHMP1.5C18-ORF2, CHMP1b, chromatin modifying protein 1B, Chromatin-modifying protein 1b, hVps46-2, vacuolar protein sorting 46-2, Vacuolar protein sorting-associated protein 46-2, Vps46-2, Vps46B | |
CHMP1B | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Human | |
Q7LBR1 | |
57132 | |
This antibody was developed against a recombinant protein corresponding to amino acids: TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title