CHMP2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP184482

Catalog No. NBP184482

Description

CHMP2B Polyclonal specifically detects CHMP2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CHMP2B
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: charged multivesicular body protein 2b, CHMP2.5VPS2BVPS2-2, CHMP2b, chromatin modifying protein 2B, Chromatin-modifying protein 2b, DKFZP564O123, DMT1, hVps2-2, Vacuolar protein sorting-associated protein 2-2, vacuolar protein-sorting-associated protein 2-2, VPS2 homolog B, Vps2-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25978
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CHMP2B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKM
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only