Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHMP2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $612.50
Specifications
Antigen | CHMP2B |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CHMP2B Polyclonal specifically detects CHMP2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CHMP2B | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
25978 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKM | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
charged multivesicular body protein 2b, CHMP2.5VPS2BVPS2-2, CHMP2b, chromatin modifying protein 2B, Chromatin-modifying protein 2b, DKFZP564O123, DMT1, hVps2-2, Vacuolar protein sorting-associated protein 2-2, vacuolar protein-sorting-associated protein 2-2, VPS2 homolog B, Vps2-2 | |
CHMP2B | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title