Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHMP4C Antibody, Novus Biologicals™
SDP

Catalog No. NB433928 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB433928 25ul
NBP181166 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB433928 Supplier Novus Biologicals Supplier No. NBP18116625UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CHMP4C Polyclonal specifically detects CHMP4C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CHMP4C
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q96CF2
Gene Alias charged multivesicular body protein 4c, CHMP4c, chromatin modifying protein 4C, Chromatin-modifying protein 4c, hSnf7-3, hVps32-3, MGC22825, Shax3, SNF7 homolog associated with Alix 3, Snf7 homologue associated with Alix 3, SNF7-3, Vacuolar protein sorting-associated protein 32-3, Vps32-3, VPS32C
Gene Symbols CHMP4C
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 92421
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.