Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CHN 1 Antibody, Novus Biologicals™

CHN 1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15832620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15832620 20 μL
NBP158326 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15832620 Supplier Novus Biologicals Supplier No. NBP15832620UL

Description

Rabbit Polyclonal Antibody

CHN 1 Polyclonal specifically detects CHN 1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen CHN 1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P15882
Gene Alias a2-chimaerin, A-chimaerin, alpha-chimerin, ARHGAP2RhoGAP2, chimerin (chimaerin) 1, CHNDuane retraction syndrome 2, DURS2, NC, N-chimaerin, N-chimerin, Rho GTPase-activating protein 2, RHOGAP2
Gene Symbols CHN1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CHN1(chimerin (chimaerin) 1) The peptide sequence was selected from the middle region of CHN1. Peptide sequence KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1123
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.