Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Choline Kinase beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18563225UL
Description
Choline Kinase beta Polyclonal specifically detects Choline Kinase beta in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Choline Kinase beta | |
Polyclonal | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CHKB | |
This antibody was developed against Recombinant Protein corresponding to amino acids:CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWS | |
25 μL | |
Checkpoint signaling, DNA Repair | |
1120 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
0.05mg/mL | |
Immunohistochemistry 1:20-1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
CHETKcholine/ethanolamine kinase beta, CHKLcholine kinase-like, choline kinase betaEK, Choline kinase-like protein, CK, CKB, CKEKBEKBcholine/ethanolamine kinase, EC 2.7.1.32, EC 2.7.1.82, Ethanolamine kinase, Ethanolamine kinase beta | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction