Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Choline Kinase beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Choline Kinase beta |
---|---|
Concentration | 0.05mg/mL |
Dilution | Immunohistochemistry 1:20-1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Description
Choline Kinase beta Polyclonal specifically detects Choline Kinase beta in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Choline Kinase beta | |
Immunohistochemistry 1:20-1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Checkpoint signaling, DNA Repair | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
1120 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
0.05mg/mL | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
CHETKcholine/ethanolamine kinase beta, CHKLcholine kinase-like, choline kinase betaEK, Choline kinase-like protein, CK, CKB, CKEKBEKBcholine/ethanolamine kinase, EC 2.7.1.32, EC 2.7.1.82, Ethanolamine kinase, Ethanolamine kinase beta | |
CHKB | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title