CHST11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168912

Catalog No. NBP168912

Description

CHST11 Polyclonal specifically detects CHST11 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: CHST11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C4S-1, C4ST, C4St-1, C4ST1EC 2.8.2.5, carbohydrate (chondroitin 4) sulfotransferase 11, carbohydrate sulfotransferase 11, Chondroitin 4-O-sulfotransferase 1, Chondroitin 4-sulfotransferase 1, DKFZp667A035, FLJ41682, HSA269537, IgH/CHST11 fusion
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P69478
• Gene Symbols: CHST11
• Immunogen: Synthetic peptides corresponding to Chst11 (carbohydrate (chondroitin 4) sulfotransferase 11) The peptide sequence was selected from the C terminal of Chst11. Peptide sequence FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 50515
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.