Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHST11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1689220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1689220 20 μL
NBP168912 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1689220 Supplier Novus Biologicals Supplier No. NBP16891220UL

Rabbit Polyclonal Antibody

CHST11 Polyclonal specifically detects CHST11 in Rat samples. It is validated for Western Blot.

Specifications

Antigen CHST11
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P69478
Gene Alias C4S-1, C4ST, C4St-1, C4ST1EC 2.8.2.5, carbohydrate (chondroitin 4) sulfotransferase 11, carbohydrate sulfotransferase 11, Chondroitin 4-O-sulfotransferase 1, Chondroitin 4-sulfotransferase 1, DKFZp667A035, FLJ41682, HSA269537, IgH/CHST11 fusion
Gene Symbols CHST11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Chst11 (carbohydrate (chondroitin 4) sulfotransferase 11) The peptide sequence was selected from the C terminal of Chst11. Peptide sequence FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS.
Molecular Weight of Antigen 38 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 50515
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.