Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHTF18 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157606 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157606 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157606 Supplier Novus Biologicals Supplier No. NBP157606
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CHTF18 Polyclonal specifically detects CHTF18 in Human samples. It is validated for Western Blot.

Specifications

Antigen CHTF18
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8WVB6
Gene Alias C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae), EC 3.6.1, hCTF18, homolog of yeast CHL12, RUVBL, some homology with holliday junction DNA helicase RUVB like
Gene Symbols CHTF18
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CHTF18 (CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of CHTF18)(50ug). Peptide sequence SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 63922
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.