CHTF18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255371

Catalog No. NBP255371

Description

CHTF18 Polyclonal specifically detects CHTF18 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CHTF18
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae), EC 3.6.1, hCTF18, homolog of yeast CHL12, RUVBL, some homology with holliday junction DNA helicase RUVB like
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 63922
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CHTF18
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQTKQL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only