CIB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258792

Catalog No. NBP258792

Description

CIB1 Polyclonal specifically detects CIB1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CIB1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: calcium and integrin binding 1 (calmyrin), Calcium- and integrin-binding protein, calmyrin, CIBcalcium and integrin binding protein, CIBP, DNA-dependent protein kinase interacting protein, DNA-PKcs-interacting protein, Kinase-interacting protein, KIP1, KIPcalcium and integrin binding, protein kinase interacting protein, PRKDCIP, SIP2-28calcium and integrin-binding protein 1, Snk interacting protein 2-28, SNK-interacting protein 2-28
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CIB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10519
• Target Species: Human
• Isotype: IgG

For Research Use Only