Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CIB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | CIB1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CIB1 Polyclonal specifically detects CIB1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| CIB1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| calcium and integrin binding 1 (calmyrin), Calcium- and integrin-binding protein, calmyrin, CIBcalcium and integrin binding protein, CIBP, DNA-dependent protein kinase interacting protein, DNA-PKcs-interacting protein, Kinase-interacting protein, KIP1, KIPcalcium and integrin binding, protein kinase interacting protein, PRKDCIP, SIP2-28calcium and integrin-binding protein 1, Snk interacting protein 2-28, SNK-interacting protein 2-28 | |
| CIB1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 10519 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title