CIP29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188084

Catalog No. NBP188084

Description

CIP29 Polyclonal specifically detects CIP29 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CIP29
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: CIP29Hcc-1, cytokine induced protein 29 kDa, Cytokine-induced protein of 29 kDa, HCC1MGC14726, hepatocellular carcinoma 1, HSPC316, Nuclear protein Hcc-1, proliferation associated cytokine-inducible protein CIP29, Proliferation-associated cytokine-inducible protein CIP29, SAP domain containing ribonucleoprotein, SAP domain-containing ribonucleoprotein, THO1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84324
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SARNP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only