CKII alpha prime polypeptide Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP156690	100 μL

Catalog No. NBP156690 Supplier Novus Biologicals Supplier No. NBP156690

Description

Rabbit Polyclonal Antibody

CKII alpha prime polypeptide Polyclonal specifically detects CKII alpha prime polypeptide in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CKII alpha prime polypeptide
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P19784
• Gene Alias: casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934
• Gene Symbols: CSNK2A2
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Protein Kinase, Wnt Signaling Pathway
• Primary or Secondary: Primary
• Gene ID (Entrez): 1459
• Test Specificity: This product is specific to Subunit or Isoform: alpha'.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only