CKS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP186336

Catalog No. NBP186336

Description

CKS2 Polyclonal specifically detects CKS2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CKS2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CDC28 protein kinase 2, CDC28 protein kinase regulatory subunit 2, CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2, CKS-2, CKSHS2, cyclin-dependent kinases regulatory subunit 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CKS2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers
• Gene ID (Entrez): 1164
• Target Species: Human
• Isotype: IgG

For Research Use Only