Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $666.47
Specifications
| Antigen | CKS2 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CKS2 Polyclonal specifically detects CKS2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CKS2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1164 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Unconjugated | |
| RUO | |
| Human | |
| CDC28 protein kinase 2, CDC28 protein kinase regulatory subunit 2, CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2, CKS-2, CKSHS2, cyclin-dependent kinases regulatory subunit 2 | |
| CKS2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title