Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Clathrin light chain + heavy chain Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Clathrin light chain + heavy chain |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
Clathrin light chain + heavy chain Polyclonal specifically detects Clathrin light chain + heavy chain in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Clathrin light chain + heavy chain | |
Unconjugated | |
RUO | |
clathrin light chain A, clathrin, light chain A, LCA, light polypeptide (Lca) | |
CLTA | |
IgG | |
24 kDa |
Polyclonal | |
Rabbit | |
Membrane Trafficking and Chaperones, Membrane Vesicle Markers | |
1211 | |
Synthetic peptides corresponding to CLTA (clathrin, light chain (Lca)) The peptide sequence was selected from the C terminal of CLTA. Peptide sequence KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title