Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Clathrin light chain + heavy chain Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Clathrin light chain + heavy chain
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
Regulatory Status RUO
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP169194
View Documents
Novus Biologicals
NBP169194
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Clathrin light chain + heavy chain Polyclonal specifically detects Clathrin light chain + heavy chain in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Clathrin light chain + heavy chain
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
1211
Synthetic peptides corresponding to CLTA (clathrin, light chain (Lca)) The peptide sequence was selected from the C terminal of CLTA. Peptide sequence KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Rabbit
Membrane Trafficking and Chaperones, Membrane Vesicle Markers
clathrin light chain A, clathrin, light chain A, LCA, light polypeptide (Lca)
CLTA
IgG
Affinity Purified
24 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit