Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Clathrin light chain + heavy chain Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | Clathrin light chain + heavy chain |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP169194
|
Novus Biologicals
NBP169194 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
Clathrin light chain + heavy chain Polyclonal specifically detects Clathrin light chain + heavy chain in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Clathrin light chain + heavy chain | |
Unconjugated | |
RUO | |
clathrin light chain A, clathrin, light chain A, LCA, light polypeptide (Lca) | |
CLTA | |
IgG | |
24 kDa |
Polyclonal | |
Rabbit | |
Membrane Trafficking and Chaperones, Membrane Vesicle Markers | |
1211 | |
Synthetic peptides corresponding to CLTA (clathrin, light chain (Lca)) The peptide sequence was selected from the C terminal of CLTA. Peptide sequence KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title