Claudin-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15910720UL

Catalog No. NBP15910720

Description

Claudin-1 Polyclonal specifically detects Claudin-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Claudin-1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: O95832
• Gene Symbols: CLDN1
• Immunogen: Synthetic peptides corresponding to CLDN1 (claudin 1) The peptide sequence was selected from the C terminal of CLDN1. Peptide sequence GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV.
• Quantity: 20 μL
• Research Discipline: Extracellular Matrix
• Gene ID (Entrez): 9076
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: claudin 1, claudin-1, CLD1, ILVASCSenescence-associated epithelial membrane protein, SEMP1senescence-associated epithelial membrane protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG