Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Claudin-1 Antibody, Novus Biologicals™

Claudin-1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15910720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15910720 20 μL
NBP159107 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15910720 Supplier Novus Biologicals Supplier No. NBP15910720UL

Description

Rabbit Polyclonal Antibody

Claudin-1 Polyclonal specifically detects Claudin-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Claudin-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. O95832
Gene Alias claudin 1, claudin-1, CLD1, ILVASCSenescence-associated epithelial membrane protein, SEMP1senescence-associated epithelial membrane protein 1
Gene Symbols CLDN1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CLDN1 (claudin 1) The peptide sequence was selected from the C terminal of CLDN1. Peptide sequence GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Extracellular Matrix
Primary or Secondary Primary
Gene ID (Entrez) 9076
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.