Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Claudin-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Claudin-1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15910720
|
Novus Biologicals
NBP15910720UL |
20 μL |
Each for $152.22
|
|
NBP159107
|
Novus Biologicals
NBP159107 |
100 μL |
Each for $436.00
|
|
Description
Claudin-1 Polyclonal specifically detects Claudin-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Claudin-1 | |
| Polyclonal | |
| Rabbit | |
| Extracellular Matrix | |
| claudin 1, claudin-1, CLD1, ILVASCSenescence-associated epithelial membrane protein, SEMP1senescence-associated epithelial membrane protein 1 | |
| CLDN1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| O95832 | |
| 9076 | |
| Synthetic peptides corresponding to CLDN1 (claudin 1) The peptide sequence was selected from the C terminal of CLDN1. Peptide sequence GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title