Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Claudin-15 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15926720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15926720 20 μL
NBP159267 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15926720 Supplier Novus Biologicals Supplier No. NBP15926720UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

Claudin-15 Polyclonal specifically detects Claudin-15 in Human samples. It is validated for Western Blot.

Specifications

Antigen Claudin-15
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P56746
Gene Alias claudin 15, claudin-15, FLJ42715, MGC19536
Gene Symbols CLDN15
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CLDN15(claudin 15) The peptide sequence was selected from the middle region of CLDN15. Peptide sequence LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 24146
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.