Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Claudin-18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15925020UL
Description
Claudin-18 Polyclonal specifically detects Claudin-18 in Human samples. It is validated for Western Blot.Specifications
Claudin-18 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P56856 | |
CLDN18 | |
Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the middle region of CLDN18. Peptide sequence YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
claudin 18, claudin-18, DKFZp564B2062, SFTA5, SFTPJ, surfactant associated 5, surfactant associated protein J, surfactant, pulmonary associated protein J | |
Rabbit | |
Affinity Purified | |
RUO | |
51208 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction