Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Claudin-3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310555100UL
Description
Claudin-3 Polyclonal specifically detects Claudin-3 in Mouse samples. It is validated for Western Blot.Specifications
Claudin-3 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C7orf1, claudin 3, claudin-3, Clostridium perfringens enterotoxin receptor 2, CPE-R 2, CPE-R2, CPETR2CPE-receptor 2, HRVP1, Rat ventral prostate.1 protein homolog, RVP1, ventral prostate.1 protein homolog, ventral prostate.1-like protein | |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_034032). Peptide sequence VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP | |
100 μg | |
Cell Biology, Cellular Markers, Extracellular Matrix | |
1365 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction