Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLCN1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169124 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169124 100 μL
NBP1692420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP169124 Supplier Novus Biologicals Supplier No. NBP169124
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CLCN1 Polyclonal specifically detects CLCN1 in Mouse, Rat samples. It is validated for Western Blot.

Specifications

Antigen CLCN1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias chloride channel 1, skeletal muscle, Chloride channel protein, skeletal muscle, clC-1, CLC1chloride channel protein 1, MGC138361, MGC142055
Gene Symbols CLCN1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Clcn1 (chloride channel 1) The peptide sequence was selected from the C terminal of Clcn1. Peptide sequence SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV.
Molecular Weight of Antigen 110 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1180
Test Specificity Pig: 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Mouse, Rat, Bovine, Canine, Equine, Equine, Guinea Pig, Goat, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.