Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLCN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169124
Description
CLCN1 Polyclonal specifically detects CLCN1 in Mouse, Rat samples. It is validated for Western Blot.Specifications
CLCN1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CLCN1 | |
Synthetic peptides corresponding to Clcn1 (chloride channel 1) The peptide sequence was selected from the C terminal of Clcn1. Peptide sequence SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV. | |
Affinity purified | |
RUO | |
1180 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
chloride channel 1, skeletal muscle, Chloride channel protein, skeletal muscle, clC-1, CLC1chloride channel protein 1, MGC138361, MGC142055 | |
Rabbit | |
110 kDa | |
100 μL | |
Primary | |
Pig: 86%. | |
Mouse, Rat, Bovine, Canine, Equine, Equine, Guinea Pig, Goat, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction