Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLCN5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16912320UL
Description
CLCN5 Polyclonal specifically detects CLCN5 in Mouse, Rat samples. It is validated for Western Blot.Specifications
CLCN5 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
chloride channel 5, Chloride channel protein 5, Chloride transporter ClC-5, clC-5, CLC5, CLCK2NPHL2, DENTSNPHL1, H(+)/Cl(-) exchange transporter 5, hCIC-K2, hClC-K2, nephrolithiasis 1 (X-linked), nephrolithiasis 2, X-linked, XLRH, XRN | |
Rabbit | |
83 kDa | |
20 μL | |
Primary | |
Human, Mouse, Rat | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
CLCN5 | |
Synthetic peptides corresponding to Clcn5 (chloride channel 5) The peptide sequence was selected from the middle region of Clcn5. Peptide sequence LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL. | |
Affinity Purified | |
RUO | |
1184 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction